Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V11

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/8/1988 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neutrophil Elastase (ELANE) (N-term) Rabbit Polyclonal Antibody
AP52858PU-N 400 µL

Neutrophil Elastase (ELANE) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS802138 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/1210), CF568 conjugate, 0.1mg/mL
BNC681210-100 1x 100 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Olfr46 activation kit by CRISPRa
GA203029 1 Kit

Mouse Olfr46 activation kit by CRISPRa

Sign In for Pricing
View Details
Src (Ab-529) Antibody
8B7220-AAT 50 µg

Src (Ab-529) Antibody

Sign In for Pricing
View Details
KLF14 (NM_138693) Human Recombinant Protein
TP313087L 1 mg

KLF14 (NM_138693) Human Recombinant Protein

Sign In for Pricing
View Details