Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V11

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/8/1988 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FLI1, Tag Free
HA210798-01 20 µg

Human FLI1, Tag Free

Sign In for Pricing
View Details
Human FLI1, Tag Free
HA210798-02 50 µg

Human FLI1, Tag Free

Sign In for Pricing
View Details
Human FLI1, Tag Free
HA210798-03 100 µg

Human FLI1, Tag Free

Sign In for Pricing
View Details
MMP24 Human Gene Knockout Kit (CRISPR)
KN422100 1 Kit

MMP24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Magnetic Stirrer, 7x7 inch, 115V
H3770-S 1 Each

Magnetic Stirrer, 7x7 inch, 115V

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF405S conjugate, 0.1mg/mL
BNC040896-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details