Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V11

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/8/1988 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Artery
CS627157 5x 5 µm

Frozen Tissue Sections, Artery

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B10]
TA800879BM 100 µL

PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B10]

Sign In for Pricing
View Details
Human C9orf128 (FAM221B) activation kit by CRISPRa
GA118223 1 Kit

Human C9orf128 (FAM221B) activation kit by CRISPRa

Sign In for Pricing
View Details
FGF21 Rabbit Monoclonal Antibody
TA423007 100 µL

FGF21 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
4-Anilino-4-oxobutanoic Acid
TRC-A663950-50MG 50 mg

4-Anilino-4-oxobutanoic Acid

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5 + CGA414), CF405S conjugate, 0.1mg/mL
BNC041223-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details