Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77ZL3

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/Kentucky/1/1981)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKFIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TTLL12 qPCR Primer Pair
QH34969S 200 Tests

Human TTLL12 qPCR Primer Pair

Sign In for Pricing
View Details
GSG1 Protein Lysate
OCOA15265-20UG 20 µg

GSG1 Protein Lysate

Sign In for Pricing
View Details
ZCCHC17 siRNA (Human)
MBS8216280-01 15 nmol

ZCCHC17 siRNA (Human)

Sign In for Pricing
View Details
ZCCHC17 siRNA (Human)
MBS8216280-02 30 nmol

ZCCHC17 siRNA (Human)

Sign In for Pricing
View Details
ZCCHC17 siRNA (Human)
MBS8216280-03 5x 30 nmol

ZCCHC17 siRNA (Human)

Sign In for Pricing
View Details
APOD Polyclonal Antibody
A50041-050 50 µL

APOD Polyclonal Antibody

Sign In for Pricing
View Details