Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XT33

Expression Region

1-97

Origin

Influenza A virus (strain A/Qu/7/1970 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdadc1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6379402 1.0 µg DNA

Cdadc1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
NEIL1 Recombinant Protein
OPCA02411-20UG 20 µg

NEIL1 Recombinant Protein

Sign In for Pricing
View Details
DOC4 Lentiviral Activation Particles (h)
sc-406806-LAC 200 µL

DOC4 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Vanderwaltozyma polyspora Bud site selection protein 4 (BUD4), partial
MBS1187880 Inquire

Recombinant Vanderwaltozyma polyspora Bud site selection protein 4 (BUD4), partial

Sign In for Pricing
View Details
FibuLin 7 (FBLN7) (NM_153214) Human Tagged ORF Clone
RC207815 10 µg

FibuLin 7 (FBLN7) (NM_153214) Human Tagged ORF Clone

Sign In for Pricing
View Details
RAPGEF5 siRNA (m)
sc-152703 10 µM

RAPGEF5 siRNA (m)

Sign In for Pricing
View Details