Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XT33

Expression Region

1-97

Origin

Influenza A virus (strain A/Qu/7/1970 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930431A04Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10616154 3x 1.0 µg DNA

4930431A04Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
FGFR4 Mouse mAb
orb2716925-01 50 µL

FGFR4 Mouse mAb

Sign In for Pricing
View Details
FGFR4 Mouse mAb
orb2716925-02 100 µL

FGFR4 Mouse mAb

Sign In for Pricing
View Details
Human iPSCs From Fibroblasts (Normal, Male, African American, Neonate, NIST Line)
ASE-9211 1 Vial - 0.5x 10^6 Cells

Human iPSCs From Fibroblasts (Normal, Male, African American, Neonate, NIST Line)

Sign In for Pricing
View Details
COL6A1 Antibody
MBS9412017-01 0.1 mL

COL6A1 Antibody

Sign In for Pricing
View Details
COL6A1 Antibody
MBS9412017-02 5x 0.1 mL

COL6A1 Antibody

Sign In for Pricing
View Details