Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XU12

Expression Region

1-97

Origin

Influenza A virus (strain A/Japan/305/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRNEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin alpha Recombinant Antibody, HRP Conjugated
bsm-60582R-HRP-01 20 µL

Inhibin alpha Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Inhibin alpha Recombinant Antibody, HRP Conjugated
bsm-60582R-HRP-02 100 µL

Inhibin alpha Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
RASL10A (NM_006477) Human Tagged Lenti ORF Clone
RC205271L4 10 µg

RASL10A (NM_006477) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FAM46D CRISPR Activation Plasmid (h)
sc-414919-ACT 20 µg

FAM46D CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
RPL32P3 (Ribosomal Protein L32 Pseudogene 3) (HRP)
251261-HRP 100 µL

RPL32P3 (Ribosomal Protein L32 Pseudogene 3) (HRP)

Sign In for Pricing
View Details
ATP6V1B2 Rabbit Polyclonal Antibody (APC)
orb1004948 100 µL

ATP6V1B2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details