Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XTV0

Expression Region

1-97

Origin

Influenza A virus (strain A/Tokyo/3/1967 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REXO4 Rabbit Polyclonal Antibody (Cy3)
orb2589598 100 µg

REXO4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
[IHC]beta Catenin Mouse Monoclonal Antibody, 1 pack = 100 µL
BAL3558 1 Each

[IHC]beta Catenin Mouse Monoclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details
Mmu-miR-7666-5p miRNA Agomir
CMN1787-01 5 nmol

Mmu-miR-7666-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7666-5p miRNA Agomir
CMN1787-02 10 nmol

Mmu-miR-7666-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7666-5p miRNA Agomir
CMN1787-03 20 nmol

Mmu-miR-7666-5p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Torque teno douroucouli virus Uncharacterized ORF3 protein (ORF3)
MBS1397401-01 0.05 mg (E-Coli)

Recombinant Torque teno douroucouli virus Uncharacterized ORF3 protein (ORF3)

Sign In for Pricing
View Details