Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XTV0

Expression Region

1-97

Origin

Influenza A virus (strain A/Tokyo/3/1967 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUG-2099
orb3133676-01 50 mg

TUG-2099

Sign In for Pricing
View Details
TUG-2099
orb3133676-02 10 mg

TUG-2099

Sign In for Pricing
View Details
AKR7A3 Protein Lysate (Human) with C-Ha Tag
11707033 100 µg

AKR7A3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mmu-miR-92a-3p miRNA Inhibitor
orb1870795-01 10 nmol

Mmu-miR-92a-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-92a-3p miRNA Inhibitor
orb1870795-02 20 nmol

Mmu-miR-92a-3p miRNA Inhibitor

Sign In for Pricing
View Details
CITED2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
16207156 3x 1.0 µg DNA

CITED2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details