Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XTV0

Expression Region

1-97

Origin

Influenza A virus (strain A/Tokyo/3/1967 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PKC delta (PRKCD) activation kit by CRISPRa
GA103770 1 Kit

Human PKC delta (PRKCD) activation kit by CRISPRa

Sign In for Pricing
View Details
Spo11 Rat shRNA Plasmid (Locus ID 366261)
TR707486 1 Kit

Spo11 Rat shRNA Plasmid (Locus ID 366261)

Sign In for Pricing
View Details
CYB561 AAV Vector (Human) (CMV)
17229101 1 µg

CYB561 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
5-{5-[ (4,5-dichloro-1H-imidazol-1-yl) methyl]-2-furyl}-4-methyl-4H-1,2,4-triazole-3-thiol
OR25486 1 Each

5-{5-[ (4,5-dichloro-1H-imidazol-1-yl) methyl]-2-furyl}-4-methyl-4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
SLC16A10 Antibody - C-terminal region
OAAB09542-400UL 400 µL

SLC16A10 Antibody - C-terminal region

Sign In for Pricing
View Details
Thioredoxin (Trx) Mouse ELISA Kit
H5757 96 Tests

Thioredoxin (Trx) Mouse ELISA Kit

Sign In for Pricing
View Details