Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V06

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Hong Kong/127/1982 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRLLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DDX3 (Thr322) Rabbit Polyclonal Antibody (APC)
orb1005131 100 µL

Phospho-DDX3 (Thr322) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Anti-NLRP3 Rabbit pAb
GB114320 100 μL

Anti-NLRP3 Rabbit pAb

Sign In for Pricing
View Details
DPF2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-7065R-BF405 100 µL

DPF2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Anti-Zebrafish PCCB Antibody Picoband® FITC Conjugated
AZB0V0X1-FITC 100 µg/Vial

Anti-Zebrafish PCCB Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Imidazoleglycerol-phosphate dehydratase (hisB)
MBS1470626-01 0.02 mg (E-Coli)

Recombinant Mycobacterium leprae Imidazoleglycerol-phosphate dehydratase (hisB)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Imidazoleglycerol-phosphate dehydratase (hisB)
MBS1470626-02 0.1 mg (E-Coli)

Recombinant Mycobacterium leprae Imidazoleglycerol-phosphate dehydratase (hisB)

Sign In for Pricing
View Details