Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V06

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Hong Kong/127/1982 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRLLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYP0 Polyclonal Antibody
E44H08497 100 µL

MYP0 Polyclonal Antibody

Sign In for Pricing
View Details
CLTC Rabbit Polyclonal Antibody
E10G04781 100 µL

CLTC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (MaxLight 750)
MBS6381252-01 0.1 mL

HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (MaxLight 750)

Sign In for Pricing
View Details
HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (MaxLight 750)
MBS6381252-02 5x 0.1 mL

HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (MaxLight 750)

Sign In for Pricing
View Details
Dectin 1 (CLEC7A) (NM_197950) Human Tagged ORF Clone
RC220248 10 µg

Dectin 1 (CLEC7A) (NM_197950) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Prostaglandin E Synthase, Microsomal (PTGES) ELISA Kit
orb1663899-01 48 Tests

Human Prostaglandin E Synthase, Microsomal (PTGES) ELISA Kit

Sign In for Pricing
View Details