Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77ZJ9

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/New Market/1/1977 H7N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIME (LIME1) Mouse Monoclonal Antibody [Clone ID: OTI7A9]
CF807654 100 µg

LIME (LIME1) Mouse Monoclonal Antibody [Clone ID: OTI7A9]

Sign In for Pricing
View Details
Uncoated Rat CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit
E-UNEL-R0098-01 5x 96 Tests

Uncoated Rat CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit
E-UNEL-R0098-02 15x 96 Tests

Uncoated Rat CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
ZMYND19 (NM_138462) Human Recombinant Protein
TP304509 20 µg

ZMYND19 (NM_138462) Human Recombinant Protein

Sign In for Pricing
View Details
Timd4 Mouse Gene Knockout Kit (CRISPR)
KN517569 1 Kit

Timd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KLF12 activation kit by CRISPRa
GA107773 1 Kit

Human KLF12 activation kit by CRISPRa

Sign In for Pricing
View Details