Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77ZJ9

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/New Market/1/1977 H7N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DMRT2 Human Gene Knockout Kit (CRISPR)
KN421391 1 Kit

DMRT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNA5 Rabbit Polyclonal Antibody
AP05126PU-N 100 µg

KCNA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMAGP Human Gene Knockout Kit (CRISPR)
KN424140 1 Kit

SMAGP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503853 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
3-Dehydro Retinal
TRC-D230075-5MG 5 mg

3-Dehydro Retinal

Sign In for Pricing
View Details