Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V04

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Maryland/1815/1979 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brox 3'UTR GFP Stable Cell Line
TU251424 1.0 mL

Brox 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CYP2A6 Antibody (HRP)
orb414694-01 50 µg

CYP2A6 Antibody (HRP)

Sign In for Pricing
View Details
CYP2A6 Antibody (HRP)
orb414694-02 100 µg

CYP2A6 Antibody (HRP)

Sign In for Pricing
View Details
E3 SUMO-protein ligase PIAS1 PIAS1/SUMO Rabbit Polyclonal Antibody
orb176694 100 µg

E3 SUMO-protein ligase PIAS1 PIAS1/SUMO Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BOULE Antibody
R35388-100UG 100 µg

BOULE Antibody

Sign In for Pricing
View Details
DAGLA Protein Vector (Mouse) (pPB-N-His)
PV170415 500 ng

DAGLA Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details