Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77ZK8

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/Alaska/1/1991 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKFIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttr Mouse Gene Knockout Kit (CRISPR)
KN518453 1 Kit

Ttr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Xanthine Oxidase (XOD) Activity Fluorometric Assay Kit
E-BC-F019-01 96 T (40 samples)

Xanthine Oxidase (XOD) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
Xanthine Oxidase (XOD) Activity Fluorometric Assay Kit
E-BC-F019-02 500 Assays (242 samples)

Xanthine Oxidase (XOD) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA504763AM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]

Sign In for Pricing
View Details
SOHLH2 Human Gene Knockout Kit (CRISPR)
KN423460 1 Kit

SOHLH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SULT1C2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H1]
TA502678BM 100 µL

SULT1C2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H1]

Sign In for Pricing
View Details