Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77ZK8

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/Alaska/1/1991 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKFIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC1/3 (PCSK1) (NM_000439) Human Over-expression Lysate
LC400155 20 µg

PC1/3 (PCSK1) (NM_000439) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GDF6 activation kit by CRISPRa
GA118222 1 Kit

Human GDF6 activation kit by CRISPRa

Sign In for Pricing
View Details
XRCC3 (10F1/6), CF568 conjugate, 0.1mg/mL
BNC682842-500 1x 500 µL

XRCC3 (10F1/6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), Biotin conjugate, 0.1mg/mL
BNCB0889-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GJB3 (NM_001005752) Human Over-expression Lysate
LC423651 20 µg

GJB3 (NM_001005752) Human Over-expression Lysate

Sign In for Pricing
View Details
Serine racemase (SRR) (NM_021947) Human Recombinant Protein
TP310359L 1 mg

Serine racemase (SRR) (NM_021947) Human Recombinant Protein

Sign In for Pricing
View Details