Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XT43

Expression Region

1-97

Origin

Influenza A virus (strain A/England/878/1969 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSNPLVVAASIIGILHLILWILDRLFFKCITRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 5 (PRDX5) Mouse Monoclonal Antibody [Clone ID: OTI3A1]
CF811480 100 µg

Peroxiredoxin 5 (PRDX5) Mouse Monoclonal Antibody [Clone ID: OTI3A1]

Sign In for Pricing
View Details
PRR4 (NM_001098538) Human Over-expression Lysate
LY420635 100 µg

PRR4 (NM_001098538) Human Over-expression Lysate

Sign In for Pricing
View Details
LOC105369261 Mouse Monoclonal Antibody [Clone ID: MT1]
AM39018PU-N 1 mL

LOC105369261 Mouse Monoclonal Antibody [Clone ID: MT1]

Sign In for Pricing
View Details
HMG20B Antibody
8C11798-AAT 50 µg

HMG20B Antibody

Sign In for Pricing
View Details
MSI1 Mouse Monoclonal Antibody [Clone ID: 2A12]
AM06590SU-N 100 µL

MSI1 Mouse Monoclonal Antibody [Clone ID: 2A12]

Sign In for Pricing
View Details
2-Chloro-3-formylthiophene
TRC-C383643-500MG 500 mg

2-Chloro-3-formylthiophene

Sign In for Pricing
View Details