Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6XT43

Expression Region

1-97

Origin

Influenza A virus (strain A/England/878/1969 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSNPLVVAASIIGILHLILWILDRLFFKCITRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V-Elab Fluor® 488 Azide-Free Lyophilized Powder
E-CK-A137U-01 25 µg

Annexin V-Elab Fluor® 488 Azide-Free Lyophilized Powder

Sign In for Pricing
View Details
Annexin V-Elab Fluor® 488 Azide-Free Lyophilized Powder
E-CK-A137U-02 100 µg

Annexin V-Elab Fluor® 488 Azide-Free Lyophilized Powder

Sign In for Pricing
View Details
Beta-Nicotinamide Adenine Dinucleotide
TRC-N407784-5G 5 g

Beta-Nicotinamide Adenine Dinucleotide

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS714982 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Cortisol 21-Benzoate
TRC-C696310-25MG 25 mg

Cortisol 21-Benzoate

Sign In for Pricing
View Details
N-Acetylisoleucine
TRC-A192295-50MG 50 mg

N-Acetylisoleucine

Sign In for Pricing
View Details