Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77ZL5

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/New Market/1979 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKFIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRABP2 (NM_001878) Human Over-expression Lysate
LC419677 20 µg

CRABP2 (NM_001878) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF568 conjugate, 0.1mg/mL
BNC681707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSUN5 Human Gene Knockout Kit (CRISPR)
KN200144 1 Kit

NSUN5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MUC4 Recombinant Rabbit Monoclonal Antibody [JM19-36]
ET1705-13 100 µL

MUC4 Recombinant Rabbit Monoclonal Antibody [JM19-36]

Sign In for Pricing
View Details
ZFP200 (ZNF200) (NM_198088) Human Recombinant Protein
TP760732 50 µg

ZFP200 (ZNF200) (NM_198088) Human Recombinant Protein

Sign In for Pricing
View Details
Spcs2 Mouse Gene Knockout Kit (CRISPR)
KN516574 1 Kit

Spcs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details