Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q89687

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/May/1954 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWGCRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRLEYGLK RGPSTEGLPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mboat2 activation kit by CRISPRa
GA207204 1 Kit

Mouse Mboat2 activation kit by CRISPRa

Sign In for Pricing
View Details
TropomoduLin 1 (TMOD1) (NM_001166116) Human Over-expression Lysate
LY431319 100 µg

TropomoduLin 1 (TMOD1) (NM_001166116) Human Over-expression Lysate

Sign In for Pricing
View Details
KCNIP4 Antibody
KC-17354-01 50 μL

KCNIP4 Antibody

Sign In for Pricing
View Details
KCNIP4 Antibody
KC-17354-02 100 µL

KCNIP4 Antibody

Sign In for Pricing
View Details
KCNIP4 Antibody
KC-17354-03 1 mL

KCNIP4 Antibody

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF740 conjugate, 0.1mg/mL
BNC742250-100 1x 100 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details