Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q89687

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/May/1954 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWGCRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRLEYGLK RGPSTEGLPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF4 Antibody
KC-24842-01 50 μL

KLF4 Antibody

Sign In for Pricing
View Details
KLF4 Antibody
KC-24842-02 100 µL

KLF4 Antibody

Sign In for Pricing
View Details
KLF4 Antibody
KC-24842-03 1 mL

KLF4 Antibody

Sign In for Pricing
View Details
SEC23 (SEC23A) Rabbit Polyclonal Antibody
TA361395 100 µL

SEC23 (SEC23A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Aly (ALYREF) activation kit by CRISPRa
GA106921 1 Kit

Human Aly (ALYREF) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS701554 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details