Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q8BAC4

Expression Region

1-97

Origin

Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) (Influenza A virus (strain A/South Carolina/1/1918 H1N1) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWGCRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRKEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR17 Antibody, HRP conjugated
MBS1498892-01 0.05 mg

GPR17 Antibody, HRP conjugated

Sign In for Pricing
View Details
GPR17 Antibody, HRP conjugated
MBS1498892-02 0.1 mg

GPR17 Antibody, HRP conjugated

Sign In for Pricing
View Details
GPR17 Antibody, HRP conjugated
MBS1498892-03 5x 0.1 mg

GPR17 Antibody, HRP conjugated

Sign In for Pricing
View Details
RNF7 Protein Vector (Rat) (pPM-C-HA)
PV301960 500 ng

RNF7 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
C1S Blocking Peptide
MBS9624134-01 1 mg

C1S Blocking Peptide

Sign In for Pricing
View Details
C1S Blocking Peptide
MBS9624134-02 5x 1 mg

C1S Blocking Peptide

Sign In for Pricing
View Details