Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q8BAC4

Expression Region

1-97

Origin

Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) (Influenza A virus (strain A/South Carolina/1/1918 H1N1) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWGCRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRKEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdip1 (NM_025670) Mouse Tagged ORF Clone
MR202210 10 µg

Cdip1 (NM_025670) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Acetyl-PARP1 (K521) Antibody
A71094-100UG 100 µg

Acetyl-PARP1 (K521) Antibody

Sign In for Pricing
View Details
Phospho-TRIM28 (Ser824) Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-63001R-BF680 100 µL

Phospho-TRIM28 (Ser824) Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
GTDC1 Polyclonal Antibody, Cy5.5 Conjugated
bs-8582R-Cy5.5 100 µL

GTDC1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
MARCH3 Polyclonal Antibody
MBS8523625-01 0.1 mg

MARCH3 Polyclonal Antibody

Sign In for Pricing
View Details
MARCH3 Polyclonal Antibody
MBS8523625-02 0.1 mL (AF635)

MARCH3 Polyclonal Antibody

Sign In for Pricing
View Details