Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q8BAC4

Expression Region

1-97

Origin

Influenza A virus (strain A/Brevig Mission/1/1918 H1N1) (Influenza A virus (strain A/South Carolina/1/1918 H1N1) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWGCRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRKEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOC3 Like DNA Replication Regulator (NOC3L) Antibody
abx008066-01 30 µL

NOC3 Like DNA Replication Regulator (NOC3L) Antibody

Sign In for Pricing
View Details
NOC3 Like DNA Replication Regulator (NOC3L) Antibody
abx008066-02 100 µL

NOC3 Like DNA Replication Regulator (NOC3L) Antibody

Sign In for Pricing
View Details
NOC3 Like DNA Replication Regulator (NOC3L) Antibody
abx008066-03 200 µL

NOC3 Like DNA Replication Regulator (NOC3L) Antibody

Sign In for Pricing
View Details
TIP120A (CAND1) (NM_018448) Human Tagged Lenti ORF Clone
RC208212L4 10 µg

TIP120A (CAND1) (NM_018448) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Atypical Chemokine Receptor D6 Antibody
STJ500031 100 µg

Anti-Atypical Chemokine Receptor D6 Antibody

Sign In for Pricing
View Details
Anti-Siglec-8 Reference Antibody (lirentelimab)
E24CHA094 100 µg

Anti-Siglec-8 Reference Antibody (lirentelimab)

Sign In for Pricing
View Details