Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanopyrus kandleri Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanopyrus kandleri Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

Q8TY29

Expression Region

1-97

Origin

Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDPGLVAVGVAAAVAFGTALALGLPPIQRDKPRRKSWEVSAAFPTPVIAAGATVLVIRV IGYHPPIPLAIVGAVVGALSAAFTAYIEKVFPRPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Alpha-1-Antiproteinase (SERPINA1) ELISA Kit-Sandwich
EK11F728-01 48 Test

Bovine Alpha-1-Antiproteinase (SERPINA1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Alpha-1-Antiproteinase (SERPINA1) ELISA Kit-Sandwich
EK11F728-02 96 Tests

Bovine Alpha-1-Antiproteinase (SERPINA1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
ORAOV1 CRISPR Activation Plasmid (m2)
sc-428298-ACT-2 20 µg

ORAOV1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Anti-TPCN2 Antibody Picoband® Fluoro488 Conjugated
A05187-1-Fluoro488 100 µg/Vial

Anti-TPCN2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
MIST1 (A-6) AC
sc-166181 AC 500 µg/mL - 25% ag

MIST1 (A-6) AC

Sign In for Pricing
View Details
Toll-Like Receptor 2 (TLR2) Antibody
abx421849-01 50 µg

Toll-Like Receptor 2 (TLR2) Antibody

Sign In for Pricing
View Details