Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q8QV59

Expression Region

1-97

Origin

Influenza A virus (strain A/Philippines/2/1982 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDSLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Serine-protein kinase ATM ATM Antibody Picoband® Fluoro647 Conjugated
RP1040-Fluoro647 100 µg/Vial

Anti-Serine-protein kinase ATM ATM Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal XPG Antibody (8H7/XPG) [FITC]
NBP2-50366F 0.1 mL

Mouse Monoclonal XPG Antibody (8H7/XPG) [FITC]

Sign In for Pricing
View Details
DYNLL1 Antibody - middle region : Biotin (ARP51261_P050-Biotin)
ARP51261_P050-Biotin 100 µL

DYNLL1 Antibody - middle region : Biotin (ARP51261_P050-Biotin)

Sign In for Pricing
View Details
Human MMR/CD206 MAb (Clone 309210)
MAB2534 100 µg

Human MMR/CD206 MAb (Clone 309210)

Sign In for Pricing
View Details
Lactate Dehydrogenase, pan (LDH, Malaria) (MaxLight 750) discontinued
227050-ML750 100 µL

Lactate Dehydrogenase, pan (LDH, Malaria) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PEnCMV-Hspb1-m-3xFLAG
BZ21075 1 Vial

PEnCMV-Hspb1-m-3xFLAG

Sign In for Pricing
View Details