Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q8QV59

Expression Region

1-97

Origin

Influenza A virus (strain A/Philippines/2/1982 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDSLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal ROCK2 Antibody (C-term)
APR04826G 0.1ml

Polyclonal ROCK2 Antibody (C-term)

Sign In for Pricing
View Details
DLSTP1 3'UTR Lenti-reporter-Luc Vector
18294081 1.0 µg

DLSTP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DEGS1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62716R-BF488 100 µL

DEGS1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Mrgprb13 (NM_001002283) Rat Tagged Lenti ORF Clone
RR212767L4 10 µg

Mrgprb13 (NM_001002283) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tuba1a sgRNA CRISPR Lentivector set (Rat)
K6967201 3x 1.0 µg

Tuba1a sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human RBP3 (Retinol Binding Protein 3, Interstitial) CLIA Kit
MBS2532081-01 96 Tests

Human RBP3 (Retinol Binding Protein 3, Interstitial) CLIA Kit

Sign In for Pricing
View Details