Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 167 (Ccdc167)

This Recombinant Mouse Coiled-coil domain-containing protein 167 (Ccdc167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q9D162

Expression Region

1-97

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLEKEKHTLMNKA SKYEKELKLLRHENRKNTLLSVAIFTVFALLYAYWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRH1 Rabbit pAb, IRDye 800CW conjugated
orb2882752 100 µL

HRH1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
NCI-H1299-Cas9 Cell Line
RG-047 1x 10^6

NCI-H1299-Cas9 Cell Line

Sign In for Pricing
View Details
ZNF57 Peptide (AAP39986)
AAP39986-100UG 100 µg

ZNF57 Peptide (AAP39986)

Sign In for Pricing
View Details
AK3L1   monoclonal antibody
MB11911 50ul

AK3L1 monoclonal antibody

Sign In for Pricing
View Details
Apcin
C14355-1g 1 g

Apcin

Sign In for Pricing
View Details
RUNX3 3'UTR Lenti-reporter-Luc Vector
42891081 1.0 µg

RUNX3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details