Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 167 (Ccdc167)

This Recombinant Mouse Coiled-coil domain-containing protein 167 (Ccdc167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q9D162

Expression Region

1-97

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLEKEKHTLMNKA SKYEKELKLLRHENRKNTLLSVAIFTVFALLYAYWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5D Polyclonal Antibody, HRP Conjugated
A50066-100 100 µL

ATP5D Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Compound NP-005924
T130611-01 10 mg

Compound NP-005924

Sign In for Pricing
View Details
Compound NP-005924
T130611-02 1 g

Compound NP-005924

Sign In for Pricing
View Details
Compound NP-005924
T130611-03 1 mg

Compound NP-005924

Sign In for Pricing
View Details
Compound NP-005924
T130611-04 50 mg

Compound NP-005924

Sign In for Pricing
View Details
Compound NP-005924
T130611-05 5 mg

Compound NP-005924

Sign In for Pricing
View Details