Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 167 (CCDC167)

This Recombinant Human Coiled-coil domain-containing protein 167 (CCDC167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q9P0B6

Expression Region

1-97

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKA SNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gadd45g AAV siRNA Pooled Vector
21176164 1.0 µg

Gadd45g AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Olfr1336 (NM_146915) Mouse Untagged Clone
MC214045 10 µg

Olfr1336 (NM_146915) Mouse Untagged Clone

Sign In for Pricing
View Details
Park7 3'UTR Lenti-reporter-Luc Vector
36018084 1.0 µg

Park7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Bovine Cardiotrophin 1 ELISA Kit
MBS037825-01 48 Well

Bovine Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Cardiotrophin 1 ELISA Kit
MBS037825-02 96 Well

Bovine Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Cardiotrophin 1 ELISA Kit
MBS037825-03 5x 96 Well

Bovine Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details