Recombinant Human Coiled-coil domain-containing protein 167 (CCDC167)
This Recombinant Human Coiled-coil domain-containing protein 167 (CCDC167) spans the amino acid sequence from region 1-97.
Product Specifications
Product Name Alternative
Coiled-coil domain-containing protein 167
UniProt
Q9P0B6
Expression Region
1-97
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKA SNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6493072-01 0.1 mL
PIP5K2G, CT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 gamma, Phosphatidylinositol-5-phosphate 4-kinase Type II gamma, PI(5)P 4-kinase Type II gamma, PIP4KII-gamma, PIP4K2C, PIP5K2C) (MaxLight 405)
Sign In for Pricing
View Details MBS6493072-02 5x 0.1 mL
PIP5K2G, CT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 gamma, Phosphatidylinositol-5-phosphate 4-kinase Type II gamma, PI(5)P 4-kinase Type II gamma, PIP4KII-gamma, PIP4K2C, PIP5K2C) (MaxLight 405)
Sign In for Pricing
View Details LS000862-100ug 100 µg
RUNX1T1 (NM_175634) Human Over-expression Lysate
Sign In for Pricing
View Details OR1059472-01 100 mg
3,4-Dichloro-5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) pyridine
Sign In for Pricing
View Details