Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 167 (CCDC167)

This Recombinant Human Coiled-coil domain-containing protein 167 (CCDC167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q9P0B6

Expression Region

1-97

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKA SNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Peptidyl-prolyl Cis-trans isomerase-Like 1 (PPIL1) ELISA
KBH0758 1x 96 Well

GENLISA™ Human Peptidyl-prolyl Cis-trans isomerase-Like 1 (PPIL1) ELISA

Sign In for Pricing
View Details
PRSM2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1732705 3x 1.0 µg

PRSM2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bovine Nuclear receptor ROR-gamma ELISA kit
GTR10436004 96 Well

Bovine Nuclear receptor ROR-gamma ELISA kit

Sign In for Pricing
View Details
OTOP3 Recombinant Protein (Mouse)
RP159617 100 µg

OTOP3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Human GSTT2 Protein
E30P6348 20 µg

Recombinant Human GSTT2 Protein

Sign In for Pricing
View Details
Gasdermin D (Gasdermin-D, GSDMD, DF5L, DFNA5L, FKSG10, FLJ12150, Gasdermin Domain Containing Protein 1, GSDMDC1) APC
MBS6380320-01 0.1 mL

Gasdermin D (Gasdermin-D, GSDMD, DF5L, DFNA5L, FKSG10, FLJ12150, Gasdermin Domain Containing Protein 1, GSDMDC1) APC

Sign In for Pricing
View Details