Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ycf49 (ycf49)

This Recombinant Uncharacterized protein ycf49 (ycf49) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Uncharacterized protein ycf49

UniProt

Q9TM18

Expression Region

1-97

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSLSLPTWNIHIVTLVEWSIVIRLIYLFTYFYDIPRSFNFLIIILMIFFFLSGLFACCW HFFNNNSILLWISVAQAALTAFSNFFFLLFISAYYHK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL13RA1 protein
orb594811-01 10 µg

Human IL13RA1 protein

Sign In for Pricing
View Details
Human IL13RA1 protein
orb594811-02 50 µg

Human IL13RA1 protein

Sign In for Pricing
View Details
Human IL13RA1 protein
orb594811-03 500 µg

Human IL13RA1 protein

Sign In for Pricing
View Details
Human IL13RA1 protein
orb594811-04 1 mg

Human IL13RA1 protein

Sign In for Pricing
View Details
AGFG1 Recombinant Protein (Human)
RP000715 100 µg

AGFG1 Recombinant Protein (Human)

Sign In for Pricing
View Details
RAB13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1771708 1.0 µg DNA

RAB13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details