Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T4

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/96.1/2002 H5N1 genotype Y)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSGSSDPLVVAANIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTKGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Aortic valve
CS705145 5x 5 µm

Tissue FFPE Sections, Aortic valve

Sign In for Pricing
View Details
Sart1 Mouse Gene Knockout Kit (CRISPR)
KN515303 1 Kit

Sart1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Formic Acid-13C
TRC-F692902-50MG 50 mg

Formic Acid-13C

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), Biotin conjugate, 0.1mg/mL
BNCB1930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JRK (NM_001077527) Human Over-expression Lysate
LY421459 100 µg

JRK (NM_001077527) Human Over-expression Lysate

Sign In for Pricing
View Details
Diethyl Pimelate
TRC-D444833-500MG 500 mg

Diethyl Pimelate

Sign In for Pricing
View Details