Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T4

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/96.1/2002 H5N1 genotype Y)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSGSSDPLVVAANIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTKGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Cumylphenol
TRC-C834580-5G 5 g

4-Cumylphenol

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS803379 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
IRF6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]
TA503382BM 100 µL

IRF6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody
HA723870B 100 µL

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC472562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), 0.2mg/mL
BNUB0898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), 0.2mg/mL

Sign In for Pricing
View Details