Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T3

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/715.5/2001 H5N1 genotype E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSGSSDPLVVASSIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL18R1/CD218a Protein (His Tag)
PKSM040867-01 100 µg

Recombinant Mouse IL18R1/CD218a Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL18R1/CD218a Protein (His Tag)
PKSM040867-02 1 mg

Recombinant Mouse IL18R1/CD218a Protein (His Tag)

Sign In for Pricing
View Details
Cooled Incubator BICL-6004
BICL-6004 1 Unit

Cooled Incubator BICL-6004

Sign In for Pricing
View Details
UACA / Nucling (UACA/1222), Biotin conjugate, 0.1mg/mL
BNCB1222-100 1x 100 µL

UACA / Nucling (UACA/1222), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4beta-Hydroxy Cholesterol 4-Acetate
TRC-H917985-25MG 25 mg

4beta-Hydroxy Cholesterol 4-Acetate

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF405S conjugate, 0.1mg/mL
BNC041475-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details