Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T3

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/715.5/2001 H5N1 genotype E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSGSSDPLVVASSIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf51A (NM_001144064) Human Over-expression Lysate
LY428491 100 µg

CXorf51A (NM_001144064) Human Over-expression Lysate

Sign In for Pricing
View Details
YIF1B Rabbit Polyclonal Antibody
TA361745 100 µL

YIF1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR92 (NM_138458) Human Recombinant Protein
TP308985L 1 mg

WDR92 (NM_138458) Human Recombinant Protein

Sign In for Pricing
View Details
FCRL1 (NM_052938) Human Over-expression Lysate
LY403271 100 µg

FCRL1 (NM_052938) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS700952 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Bone marrow stromal cell antigen 1 (BST1) Mouse Monoclonal Antibody [Clone ID: RF3]
AM26424PU-N 100 µg

Bone marrow stromal cell antigen 1 (BST1) Mouse Monoclonal Antibody [Clone ID: RF3]

Sign In for Pricing
View Details