Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T0

Expression Region

1-97

Origin

Influenza A virus (strain A/Silky Chicken/Hong Kong/SF189/2001 H5N1 genotype A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF19 Antibody
A16201-100UG 100 µg

TCF19 Antibody

Sign In for Pricing
View Details
RNF212 Adenovirus (Human)
40289051 1.0 mL

RNF212 Adenovirus (Human)

Sign In for Pricing
View Details
Mouse Gcsh activation kit by CRISPRa
GA207690 1 Kit

Mouse Gcsh activation kit by CRISPRa

Sign In for Pricing
View Details
Tesaglitazar
021384 10 mg

Tesaglitazar

Sign In for Pricing
View Details
Canine C-type lectin domain family 6 member A (CLEC6A) ELISA Kit
MBS7230701-01 48 Well

Canine C-type lectin domain family 6 member A (CLEC6A) ELISA Kit

Sign In for Pricing
View Details
Canine C-type lectin domain family 6 member A (CLEC6A) ELISA Kit
MBS7230701-02 96 Well

Canine C-type lectin domain family 6 member A (CLEC6A) ELISA Kit

Sign In for Pricing
View Details