Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T0

Expression Region

1-97

Origin

Influenza A virus (strain A/Silky Chicken/Hong Kong/SF189/2001 H5N1 genotype A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAR1 (Cell Division Cycle and Apoptosis Regulator Protein 1, Cell Cycle and Apoptosis Regulatory Protein 1, CARP-1, Death inducer with SAP Domain, CCAR1, CARP1, DIS) discontinued
221421-01 50 µL

CCAR1 (Cell Division Cycle and Apoptosis Regulator Protein 1, Cell Cycle and Apoptosis Regulatory Protein 1, CARP-1, Death inducer with SAP Domain, CCAR1, CARP1, DIS) discontinued

Sign In for Pricing
View Details
CCAR1 (Cell Division Cycle and Apoptosis Regulator Protein 1, Cell Cycle and Apoptosis Regulatory Protein 1, CARP-1, Death inducer with SAP Domain, CCAR1, CARP1, DIS) discontinued
221421-02 100 µL

CCAR1 (Cell Division Cycle and Apoptosis Regulator Protein 1, Cell Cycle and Apoptosis Regulatory Protein 1, CARP-1, Death inducer with SAP Domain, CCAR1, CARP1, DIS) discontinued

Sign In for Pricing
View Details
UAP1L1 Antibody
orb1558524-01 50 μL

UAP1L1 Antibody

Sign In for Pricing
View Details
UAP1L1 Antibody
orb1558524-02 100 µL

UAP1L1 Antibody

Sign In for Pricing
View Details
UAP1L1 Antibody
orb1558524-03 200 µL

UAP1L1 Antibody

Sign In for Pricing
View Details
THBS1 Polyclonal Antibody
MBS2529335-01 0.02 mL

THBS1 Polyclonal Antibody

Sign In for Pricing
View Details