Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T0

Expression Region

1-97

Origin

Influenza A virus (strain A/Silky Chicken/Hong Kong/SF189/2001 H5N1 genotype A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XKR6 Double Nickase Plasmid (h)
sc-415450-NIC 20 µg

XKR6 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Rat Mark2 Pre-designed siRNA Set B
SI208142B 1 Each

Rat Mark2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MFN2 antibody - N-terminal region (ARP42419_P050)
ARP42419_P050 100 µL

MFN2 antibody - N-terminal region (ARP42419_P050)

Sign In for Pricing
View Details
MSI1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1348804 1.0 µg DNA

MSI1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MTX2 (NM_006554) Human Tagged ORF Clone Lentiviral Particle
RC209825L4V 200 µL

MTX2 (NM_006554) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Zygnema circumcarinatum DNA-directed RNA polymerase subunit beta''(rpoC2), partial
MBS1417543 Inquire

Recombinant Zygnema circumcarinatum DNA-directed RNA polymerase subunit beta''(rpoC2), partial

Sign In for Pricing
View Details