Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/YU562/2001 H5N1 genotype B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSGSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARDBP Antibody (N-term)
MBS9231667-01 0.1 mL

TARDBP Antibody (N-term)

Sign In for Pricing
View Details
TARDBP Antibody (N-term)
MBS9231667-02 5x 0.1 mL

TARDBP Antibody (N-term)

Sign In for Pricing
View Details
Dicrotophos
CS-T-89491 1 Each

Dicrotophos

Sign In for Pricing
View Details
Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-3 (GABRA3), partial
MBS954643-01 1 mg (E-Coli)

Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-3 (GABRA3), partial

Sign In for Pricing
View Details
Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-3 (GABRA3), partial
MBS954643-02 1 mg (Yeast)

Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-3 (GABRA3), partial

Sign In for Pricing
View Details
Mouse Selenoprotein P1, ELISA kit
GTR10393913 96 Well

Mouse Selenoprotein P1, ELISA kit

Sign In for Pricing
View Details