Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/YU562/2001 H5N1 genotype B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSGSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Dickkopf-related protein 3 (DKK3) ELISA Kit
orb1670034-01 48 Tests

Chicken Dickkopf-related protein 3 (DKK3) ELISA Kit

Sign In for Pricing
View Details
Chicken Dickkopf-related protein 3 (DKK3) ELISA Kit
orb1670034-02 96 Tests

Chicken Dickkopf-related protein 3 (DKK3) ELISA Kit

Sign In for Pricing
View Details
CENPVL1 Rabbit Polyclonal Antibody
TA359053 100 µL

CENPVL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF26 Antibody (FITC)
orb356457-01 50 µg

RNF26 Antibody (FITC)

Sign In for Pricing
View Details
RNF26 Antibody (FITC)
orb356457-02 100 µg

RNF26 Antibody (FITC)

Sign In for Pricing
View Details
BLM Rabbit Polyclonal Antibody (Cy5.5)
orb2448535 100 µL

BLM Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details