Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T5

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/212/2003 H5N1 genotype Z+)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRNEWECRCSDSSDPLVVAANIIGILHLILWILDRLFFKCIYRRLKYGLK RGPATAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Human IL-33 alpha ELISA Kit (2 plates)
GR106354-2 2x 96 Well

Nori® Human IL-33 alpha ELISA Kit (2 plates)

Sign In for Pricing
View Details
AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (MaxLight 405)
MBS6188781-01 0.1 mL

AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (MaxLight 405)

Sign In for Pricing
View Details
AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (MaxLight 405)
MBS6188781-02 5x 0.1 mL

AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (MaxLight 405)

Sign In for Pricing
View Details
IMP4 Protein Vector (Mouse) (pPB-C-His)
PV191686 500 ng

IMP4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IL-19, Recombinant, Human, His-Tag discontinued
591107-01 20 µg

IL-19, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
IL-19, Recombinant, Human, His-Tag discontinued
591107-02 100 µg

IL-19, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details