Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T5

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/212/2003 H5N1 genotype Z+)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRNEWECRCSDSSDPLVVAANIIGILHLILWILDRLFFKCIYRRLKYGLK RGPATAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Persephin Overexpression Lysate (Native) - (Dry Ice)
NBL1-14914 0.1 mg

Persephin Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
TMEM135 Human shRNA Plasmid Kit (Locus ID 65084)
TL301014 1 Kit

TMEM135 Human shRNA Plasmid Kit (Locus ID 65084)

Sign In for Pricing
View Details
2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone
PC1023787-01 250 mg

2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details
2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone
PC1023787-02 500 mg

2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details
2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone
PC1023787-03 1 g

2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details
2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone
PC1023787-04 5 g

2,2,2-Trifluoro-1- (2-fluoro-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details