Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T6

Expression Region

1-97

Origin

Influenza A virus (strain A/Goose/Guangxi/345/2005 H5N1 genotype G)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSDSSDPLIVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO3 (NM_201559) Human Recombinant Protein
PH40625M5 20 µg

FOXO3 (NM_201559) Human Recombinant Protein

Sign In for Pricing
View Details
TMC1 Human Over-expression Lysate
orb1372999 20 µg

TMC1 Human Over-expression Lysate

Sign In for Pricing
View Details
Azurocidin, Human Neutrophil
16-14-012621-100ug 100ug

Azurocidin, Human Neutrophil

Sign In for Pricing
View Details
SF3B2 Antibody
MBS9522007-01 0.04 mL

SF3B2 Antibody

Sign In for Pricing
View Details
SF3B2 Antibody
MBS9522007-02 0.1 mL

SF3B2 Antibody

Sign In for Pricing
View Details
SF3B2 Antibody
MBS9522007-03 0.2 mL

SF3B2 Antibody

Sign In for Pricing
View Details