Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T6

Expression Region

1-97

Origin

Influenza A virus (strain A/Goose/Guangxi/345/2005 H5N1 genotype G)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSDSSDPLIVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger HIT-Type Containing 1 Human Recombinant
rAP-5081 1 Each

Zinc Finger HIT-Type Containing 1 Human Recombinant

Sign In for Pricing
View Details
Human MED8 Pre-designed siRNA Set B
SI009430B 1 Each

Human MED8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Gpbp1l1 shRNA (UAS) - Lentiviral mouse Gpbp1l1 shRNA (UAS) (25)
GTR15192641 1 Vial

Lentiviral mouse Gpbp1l1 shRNA (UAS) - Lentiviral mouse Gpbp1l1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Anti-Integrin beta 2/CD18 Polyclonal Antibody
CTA-525-01 100 µg

Rabbit Anti-Integrin beta 2/CD18 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Integrin beta 2/CD18 Polyclonal Antibody
CTA-525-02 1 mg

Rabbit Anti-Integrin beta 2/CD18 Polyclonal Antibody

Sign In for Pricing
View Details
Stromelysin-2 MMP10 Rabbit Polyclonal Antibody (Biotin)
orb2579176 100 µg

Stromelysin-2 MMP10 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details