Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T6

Expression Region

1-97

Origin

Influenza A virus (strain A/Goose/Guangxi/345/2005 H5N1 genotype G)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSDSSDPLIVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1305420 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7157703 1.0 µg DNA

RGD1305420 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human Monoclonal HTRA1/PRSS11 Antibody (FHTR2163) [Allophycocyanin]
NBP3-28037APC 0.1 mL

Human Monoclonal HTRA1/PRSS11 Antibody (FHTR2163) [Allophycocyanin]

Sign In for Pricing
View Details
TRIM23 Recombinant Rabbit mAb
orb2324815-01 25 µL

TRIM23 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TRIM23 Recombinant Rabbit mAb
orb2324815-02 50 µL

TRIM23 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TRIM23 Recombinant Rabbit mAb
orb2324815-03 100 µL

TRIM23 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Contactin Associated Protein Like Protein 5 (CNTNAP5)
MBS2073483-01 0.1 mL

PE-Linked Polyclonal Antibody to Contactin Associated Protein Like Protein 5 (CNTNAP5)

Sign In for Pricing
View Details