Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P10920

Expression Region

1-97

Origin

Influenza A virus (strain A/Singapore/1/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSEN34 Antibody - middle region (ARP77663_P050)
ARP77663_P050 100 µL

TSEN34 Antibody - middle region (ARP77663_P050)

Sign In for Pricing
View Details
MYB90 Antibody
PHY7478S 150 μg

MYB90 Antibody

Sign In for Pricing
View Details
Human DRD2 (Dopamine Receptor D2) ELISA Kit
EH26199 96 Tests

Human DRD2 (Dopamine Receptor D2) ELISA Kit

Sign In for Pricing
View Details
Anti-Nothobranchius furzeri (Turquoise killifish) LOC107376698 Antibody Cy3 Conjugated
DZ41661-Cy3 200 µL/Vial

Anti-Nothobranchius furzeri (Turquoise killifish) LOC107376698 Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Dyrk1B rabbit pAb
ES7970-01 50 µL

Dyrk1B rabbit pAb

Sign In for Pricing
View Details
Dyrk1B rabbit pAb
ES7970-02 100 µL

Dyrk1B rabbit pAb

Sign In for Pricing
View Details