Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P10920

Expression Region

1-97

Origin

Influenza A virus (strain A/Singapore/1/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-745,870 trihydrochloride
B5043-10 10 mg

L-745,870 trihydrochloride

Sign In for Pricing
View Details
C14orf80 Rabbit Polyclonal Antibody
orb3070906-01 30 µL

C14orf80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf80 Rabbit Polyclonal Antibody
orb3070906-02 50 µL

C14orf80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf80 Rabbit Polyclonal Antibody
orb3070906-03 100 µL

C14orf80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf80 Rabbit Polyclonal Antibody
orb3070906-04 200 µL

C14orf80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GADD45G Antibody - N-terminal region
OAAB11099-400UL 400 µL

GADD45G Antibody - N-terminal region

Sign In for Pricing
View Details