Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P10920

Expression Region

1-97

Origin

Influenza A virus (strain A/Singapore/1/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Chicken MHC Class II-UNLB
MBS673933-01 0.5 mg

Mouse Anti-Chicken MHC Class II-UNLB

Sign In for Pricing
View Details
Mouse Anti-Chicken MHC Class II-UNLB
MBS673933-02 5x 0.5 mg

Mouse Anti-Chicken MHC Class II-UNLB

Sign In for Pricing
View Details
GFP-Tag Polyclonal Antibody
JOT-AP00773-01 20 µL

GFP-Tag Polyclonal Antibody

Sign In for Pricing
View Details
GFP-Tag Polyclonal Antibody
JOT-AP00773-02 50 μL

GFP-Tag Polyclonal Antibody

Sign In for Pricing
View Details
GFP-Tag Polyclonal Antibody
JOT-AP00773-03 100 µL

GFP-Tag Polyclonal Antibody

Sign In for Pricing
View Details
GP5 CRISPRa sgRNA lentivector (set of three targets)(Rat)
22428126 3x 1.0µg DNA

GP5 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details